SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022165 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022165
Domain Number 1 Region: 489-549
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0028
Further Details:      
 
Domain Number 2 Region: 565-685
Classification Level Classification E-value
Superfamily PH domain-like 0.000000047
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 
Domain Number 3 Region: 717-970
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000418
Family Tricorn protease domain 2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022165   Gene: ENSLAFG00000002527   Transcript: ENSLAFT00000034331
Sequence length 1215
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_16:46944972:47073774:1 gene:ENSLAFG00000002527 transcript:ENSLAFT00000034331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESSHLEQQLEEANSVKRELDDAFRQIKAYEKQIKMLQQEREDLNKELVQASERLKNQSKE
LKDAHCQRKLAMQEFMEINERLTELHTQKQKLARHVRDKEEEVDLVMQKVESLRQELRRT
ERAKKELEVHAEALTAEASKDRKLREQSEHYSKQLENELEGLKQKQISYSPGVCSIEHQQ
EITKLKTDFEKKSIFYEEELSKREGIHANEIKNLKKELHDSEGQQLALNKEIMILKDKLE
KTRRESQSEREEFENEFKQQYEREKVLLTEENKKLTSELDKLTALYENLSTHNRRLEEEV
KDLAGKKESVAHWEAQITEIIQWVSDEKDARGYLQALASKMTEELESLRNASLGTRATDM
PWKMRRFAKLDMSARLELQSALDAEIRAKQAIQEELNKVKASNIITECKLKDSEKKNLEL
LAEIEQLIKDTEELRSEKGIEHQDSQHSFLAFLNTPPDGDQLETVDSTPFPVHTPTLKKK
GCPGSTGFPPKRKTHQFFVKSFSAPTKCHQCTSLMVGLIRQGCSCEEVCGFSCHITCVNK
APTACPVPPEQTKGPLGIDPQKGIGTAYEGHVRIPKPAGVKKGWQRALAVVCDFKLFLYD
IAEGKASQPSVVVSQVIDMRDEEFSVSAVLASDVIHASRKDIPCIFRVTASQFSTSNNKC
SILMLVDSENEKSKWVGVLSELHKILKKNKFRDRSVYVPKEAYDSTLPLIKTTQAAAIID
HERIALGNEEGLFVVHVTKDEIIRVGDNKKIHQIELIPNDQLVAVISGRNRHVRLFPMSA
LDGRETDFYKLAETKGCQTITSGKVRHGALTCLCVAMKRQVFCYELFQSKTRHRKFKEIQ
VPYNVQWMAIFSEQLCVGFQSGFLRYPLNGEGSPFSMLHSNDHTLSFIAHQPMDAICAVE
ISSKEYLLCFNSIGIYTDCQGRRSRQQELMWPANPASCCYNAPYLSVYSENAVDIFDVNS
MEWIQTLPLKKVRPLNSEGSLNLLGLETIRLIYFKNKMAEGDELVVPETSDNSRKQMVRN
INNKRRYSFRVPEEERMQQRREMLRDPEMRNKLISNPTNFNHIAHMGPGDGIQILKDLPM
NPRPQESRAVFSGSVSIPSITKSRPEPGRSMSASSGLSARSSAQNGSALKREFSGGSYNA
RRQPMPSPSEGSLSSGGMDQGSDAPARDYDGEDSDSPRHSTASNSSNLSSPPSPVSPRKT
KSLSLESTDRGSWDP
Download sequence
Identical sequences G3U2V7
ENSLAFP00000022165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]