SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022253 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022253
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-41
Family Phosphotyrosine-binding domain (PTB) 0.00000137
Further Details:      
 
Domain Number 2 Region: 436-505
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.00037
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022253
Domain Number - Region: 580-637
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000113
Family Pointed domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022253   Gene: ENSLAFG00000028030   Transcript: ENSLAFT00000035308
Sequence length 675
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_4:16270447:16279298:1 gene:ENSLAFG00000028030 transcript:ENSLAFT00000035308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHLVTFCLGEEDGVHTVEDASRKLAVMDSQGRVWAQEMLLRVSPDHVMLLDPISKEELES
YPLGAIVRCDAVVPPGRSRSLLLLVCQEPERSQPDVHFFQGLRLGAELIREDIQGAMHNY
RSGHGERRAAALRATQEELQRRPSPATETPPLQRHPSVRAVISTAGPGTGRGRPQAETIP
EAEEGFNRCESEAQEPHTTPFSILQDILNHVFDDVESFVSRLQKSAEATRVLEHRERGRR
TRRREAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIANPSSQELLHFLFGPL
QMIVDTSGGPEFASGVRRPHLTSEAVALLWDTVTPRESALWTSLGDSWNRPGAELPLEEG
PSYIPEFCSGWEPPATDPQGRAWEDPVEKQLQHERRRRQVRLKGRSKAPLRSLSMGECAP
RPDAPYYQDPELEAEPQPELTPAGKWVLCNYDFQARNSSELSVKQKDVLEVLDNSRKWWK
VRDQQGQEGYVPYNILTPHPGPQGGRSPARSLRPHWDSCDSLNNLDPSEKGFPPAEKFSQ
MLSVNEELQVRLAQGRSSPSRAAPGPRVPEPQLSPRSEASDVRAWLQAKGFSFGTVNALG
VLNGAQLFSLQKEEFRAVSPEEGTRVYSQVTVQRALLEDSEKVSELEAVMEKQKKKVEGE
TETESQPQSGIWPHH
Download sequence
Identical sequences G3U345
ENSLAFP00000022253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]