SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022571 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022571
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-30
Family Pleckstrin-homology domain (PH domain) 0.0000904
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022571
Domain Number - Region: 538-634
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0942
Family BAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022571   Gene: ENSLAFG00000007609   Transcript: ENSLAFT00000035271
Sequence length 1030
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_21:32641947:32712232:1 gene:ENSLAFG00000007609 transcript:ENSLAFT00000035271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSINKVHSFGKRDQAIRRNPNVPVVVRGWLHKQDSSGMRLWKRRWFVLADYCLFYYKVKD
SREEAVLGSIPLPSYVVSPVTPEDRISRKYSFKVAVHTGMRALIYNSSTVGSQAEHSGMR
TYYFSADTLEDMNAWVRAMNQAAQVLSRSSLKRSPSPSRDADVEKVERQAVPQANHTDAC
RECGRVGPRHARDCPHRGHDDSYGFERQEQEEEGYRSQRDPLEGKRDRSKARSPYVSAEE
DALFVDLPGGSRGQQAQPQRAEKNGMLPASYGPGEQNETGGYQRAFPPRTNSEKHSQKKS
SLAQVEHWAKASKGDGRSLPSEQTLPRQGPSQPLSFPENYQTVPKNTRHPSGSSSPPPRN
LPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAPICAGSPEFTD
QGRSRSMLEVPRSISVPPSPSDIPPPGPPRAFPPRRPHTPAERVTVKPPDQRRSVDISLD
PAKFVLRVGIMFPKTNAEPEVVHVFCDGVYTLKIAESDIDVKLSVFCEQDRILQDSEDKI
RALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAYQQRLLQEDLVHIRAELSRESTEME
NAWNEYLKLESDVEQLRQTLQEQHRRAFFFQVEKSQIQKDLWRIEDVIAGLSANKDAPGP
RTARHLLGPWGTKTKDIKNNKMSSSHLHSPDTLFSLTKGNKKSFKENSYIHPGPGSELLW
HKEPAQSSTVDGSMDTNLQPGQEAEGHKEVFMAPVGYVTSSPPHCLTGLWPELAPGRLGK
QPSCSICNSPSHPLQRPKSALERLYSGDHQRGKMSAEEQLERMKRHQKALVRERKRTLSQ
AQTPKGQEVTALNPLVCCQWKREQDFDLQLLERAMQGERKDKEENGWLKLQAMPVTELDL
EPQDYDLDISRELSKPEKVAIPERYVELDPEEPPSLEELQARYRKAEKIRSILTRSSVSN
LQSAASQDQNSVADLDSQLQEQERIINISYALASEASQRSKQVAAQQLVLLPPKAPLSSR
PTPPYPPLSN
Download sequence
Identical sequences G3U413
ENSLAFP00000022571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]