SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022637 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022637
Domain Number 1 Region: 113-212
Classification Level Classification E-value
Superfamily Immunoglobulin 6.06e-29
Family I set domains 0.00017
Further Details:      
 
Domain Number 2 Region: 213-311
Classification Level Classification E-value
Superfamily Immunoglobulin 4e-27
Family I set domains 0.0000898
Further Details:      
 
Domain Number 3 Region: 20-112
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-24
Family I set domains 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022637
Domain Number - Region: 323-364
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0416
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022637   Gene: ENSLAFG00000026803   Transcript: ENSLAFT00000036506
Sequence length 426
Comment pep:novel supercontig:loxAfr3:scaffold_4:15960947:15969391:1 gene:ENSLAFG00000026803 transcript:ENSLAFT00000036506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVCIVSFYRIKLNSSHPGYHNKPSLTAWPSHVVPVGQHVHLQCHSHFGFAMFRVYKEHGS
LVPKSQKVLSSKNFIMGPVTPAHAGIYRCYGSYHHSSTWSTPSDPLEIMVTGVYRKPSLL
AQPDPVMRLGENVTLRCSSEIMFDTYILYKEGETKDPLHLVGRFHGGNSQADFSLGSMTI
SHVGTYRCYGSFSHSPYEWSDPSDSLKLVITGVYKKPSLLAQLGSVVMSGENVTLCCHSE
SSFDMYHLSRKEDAHESWLHGVQSHSGAFQADFPLGPVTPAYGGIYRCYGSFNHSPYVWS
DPSDPLHLLVKENSTSCSPSPTEPSNQAGNLRSLHILIGLSVVILLLLIFVFFLIHRWCP
AKKNVPIPNREPEVDGMVNREDPEVEDPQEVTYSELSHWILKQKKITPTSQRSEDTPTDS
SVYVEL
Download sequence
Identical sequences G3U479
ENSLAFP00000022637 ENSLAFP00000022637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]