SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022935 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022935
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.32e-24
Family Ras-binding domain, RBD 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000022935
Domain Number - Region: 145-218
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0837
Family CSE2-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022935   Gene: ENSLAFG00000028247   Transcript: ENSLAFT00000032069
Sequence length 435
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:78246294:78247773:-1 gene:ENSLAFG00000028247 transcript:ENSLAFT00000032069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFPFPEPTMKLRYFFRSPTKDMDSEEKEIVVWVCQEEKIVCGLTKHTTSADVIQALLEEH
KTTFGEKRFLLGKPSDYCIIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAF
LPVPLWRTAEAKLVQNAEKQRELSPANYLKTLPPNKQKRIVRKTFRKLAKIKQDMVSQDR
DNMETLVHLIISQDHTIHQQVKRMKELDLEIEKCEAKFHLDWIENDGENYVQDAYLMPSF
NDVEQKLDLQYDESETLEDLNKSDGIIQLEERLKYYRMLIDKLSIEIEKEVRSVCIEINE
DAEGATAAELECSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEYELL
AEEFNLLHVSNKDGCQLKENRGKESEVPNSSENVPPFTQRVFNMYTNDTDSDTGISSNHS
QDSETTVGDVVLLST
Download sequence
Identical sequences G3U527
ENSLAFP00000018894 ENSLAFP00000022935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]