SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000022973 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000022973
Domain Number 1 Region: 353-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-78
Family Protein kinases, catalytic subunit 0.0000000143
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily PH domain-like 6.31e-38
Family Pleckstrin-homology domain (PH domain) 0.0000728
Further Details:      
 
Domain Number 3 Region: 239-387
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-29
Family SH2 domain 0.0000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000022973   Gene: ENSLAFG00000011020   Transcript: ENSLAFT00000032390
Sequence length 621
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_39:16137010:16185390:-1 gene:ENSLAFG00000011020 transcript:ENSLAFT00000032390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGCIEIKKI
RCVEKVNLAEQTPVERQYPFQIVYKEGLLYIYASMKRAEGSWHQCLREEIRGNPHLLIKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEALQSGSTQSYSPREMKKKTVIPPRPPMDAPSSS
TTVAQYDSDSKKSYGSQPNVNMQYVPREDCPDWWQVRKLKSNEDFADSNQSSSEEEENLN
DYDWFAGNISRSQSEQLLRQKGKEGAFMVRNSSQMGMYTVSLFSKAVKDKKGAVKHYHVH
TNAENKLYLAENYCFDSIPALIHYHQHNSAVIVSGLSFVIFTEGFRAPACSGASLQPRIW
ELKREEITLLKELGSGQFGVVQLGKWKGKYDIAVKMIKEGSMSEDEFFQEAQTMMKLSHP
KLVKFYGVCSKRYPIYIVTEYITNGCLLNYLKSHGKGLEPSQLLEMCYDVCEGMAFLESH
QFIHRDLAARNCLVDSDLSVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYS
SKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVVKVSQGYRLYRPQLASDTVYQIMYSCWH
ELPEKRPTFQQLLSSIEPLRE
Download sequence
Identical sequences G3U565
ENSLAFP00000022973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]