SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023018 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023018
Domain Number 1 Region: 103-268
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023018   Gene: ENSLAFG00000014651   Transcript: ENSLAFT00000026884
Sequence length 338
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:93810098:93904738:-1 gene:ENSLAFG00000014651 transcript:ENSLAFT00000026884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLQVLKINLIGHRKRILASLGDRLHDDPPQKPPRSITLREPSGNHTPPQLSPSLSQSTY
TTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQMAQTGDWGEPSITLRPPNEATAS
TPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTESTQDACAKMRANCQKSTEQMKKV
PTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSNHHYCHV
FTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPESFENKPSKPIPKPRVSIRK
SVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences G3U5B0
ENSLAFP00000023018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]