SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023088 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023088
Domain Number 1 Region: 113-219
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.07e-28
Family DEP domain 0.00000367
Further Details:      
 
Domain Number 2 Region: 225-338
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-26
Family Pleckstrin-homology domain (PH domain) 0.00000261
Further Details:      
 
Domain Number 3 Region: 5-96
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-21
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023088   Gene: ENSLAFG00000013428   Transcript: ENSLAFT00000030812
Sequence length 344
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_9:43011615:43021913:-1 gene:ENSLAFG00000013428 transcript:ENSLAFT00000030812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGHIVHNWKVRWFILRQNMLLYYKLEGGRRVTPPKGRILLDGCTIICPCLEYENRPLLIK
LKTQTSAEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHILKNSFKLPPHISLHRIV
DKMRDSSSGIRPSPNMEQGSTYKKTFIGSSLVDWLISNSFAASRLEAVTLASMLLEENFL
RPVGTRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTMDLSGTVIKQGY
LAKQGHKRKNWKVRRFVLRRDPAFLHYYDPSKEDNKPVGGFSLRGSLVSALEDNGVPTGV
KGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKQLTETGE
Download sequence
Identical sequences G3U5I0
ENSLAFP00000023088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]