SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023112 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023112
Domain Number 1 Region: 104-165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000996
Family Complement control module/SCR domain 0.0000817
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000397
Family Complement control module/SCR domain 0.0000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023112   Gene: ENSLAFG00000007463   Transcript: ENSLAFT00000028089
Sequence length 257
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:40749471:40763933:1 gene:ENSLAFG00000007463 transcript:ENSLAFT00000028089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEFCYDGPPEIRYATFKAHTYKNGTILNCECKKGFRRIRNGSPYILCTGNSSHVSWENKC
QCMSNSPWYTEKQVTSKPEQEEERKSSEMQSQMQLLDQASLPGHCREPPPWEHEAMERKY
HFVVGQTVQYQCIKGYRAQRRGRAESTCRVICGETRWTQPRLTCTNEHGLLSSPGKEEAE
SSTDTLPESEASCPSITTVSQKYTEAVTTTETFIFTTEYQIAVASCVFLLISILLLSVFT
WQRKCLAQPQRKERKNL
Download sequence
Identical sequences G3U5K4
ENSLAFP00000023112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]