SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023396 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023396
Domain Number 1 Region: 8-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-27
Family Ras-binding domain, RBD 0.0000496
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000023396
Domain Number - Region: 181-295
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023396   Gene: ENSLAFG00000027792   Transcript: ENSLAFT00000037412
Sequence length 360
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_227:31393:33003:1 gene:ENSLAFG00000027792 transcript:ENSLAFT00000037412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGLATMELKVWVDGIQRVVCGVSEQTTCQEVVIALAQAIGQTGRFVLVQRLREKERQM
LPQECPVGAQATCGQFASDVQFVLRRTGPSLAGRPSSDNCPPPERCPVRASLPPKPRPVL
GREPGKTLTFSLGLPELAPHHTPPNLAATVVVPTPGCCTDLQGLEQRVQRNAVELGQEAF
WEQELRREQAREREGQARLQALSAATSEHVARLQALDAQARALEAELRLAEEAHGPPSPT
ASAAERLRQDLASQERQSMEMQGSLALVSRALEAAEQALQAQAQELEELNRELRQCNLQQ
FIQQAGAALPPAPRPERAPAGTQDLSPPAREVPLLGAPRNPILVPSLSPEVAPTRQNSWR
Download sequence
Identical sequences G3U6D8
XP_010600658.1.64505 ENSLAFP00000023396 ENSLAFP00000023396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]