SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023859 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023859
Domain Number 1 Region: 89-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-84
Family Protein kinases, catalytic subunit 0.00000275
Further Details:      
 
Domain Number 2 Region: 977-1045
Classification Level Classification E-value
Superfamily G protein-binding domain 4.71e-26
Family RhoA-binding domain 0.000041
Further Details:      
 
Domain Number 3 Region: 1150-1239,1316-1350
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000293
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 4 Region: 1258-1307
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000023859
Domain Number - Region: 437-544
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00262
Family Myosin rod fragments 0.0022
Further Details:      
 
Domain Number - Region: 553-657
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00523
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023859   Gene: ENSLAFG00000007153   Transcript: ENSLAFT00000034938
Sequence length 1388
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_20:21064263:21219321:-1 gene:ENSLAFG00000007153 transcript:ENSLAFT00000034938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPLLTGKMPGAPEAVPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHHFFKNDQWN
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRENDSVQSRKNENKQRIQKKLYTLEEHLSNEIQAKEELEHKCKSVNTRLEKI
TKELEEEVTLRKDVESSLRQLEREKALLQHKNAEYQRKADYEAEKKRNLENDVNSLKDQL
EELKKRNQNSQISTEKVNQLQKQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCMLETAKLKLEKEFINLQSALESERRDRTHGSEIISDLQGRISGLEEDLKNGKI
LLAKVEMEKRQLQERFTDLEKEKSNMEIDMTYQLKVTQQTLEQEEAEHKATKARLADKNK
IYESIEEATSEAMKEMEKTLLEERTLKQKVENLLLEAEKRCSIFDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEIKTS
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVREFKEECEEKTKLCKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDAQDQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQFRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
EAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAANKPR
Download sequence
Identical sequences G3U7Q1
ENSLAFP00000006020 ENSLAFP00000023859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]