SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000023880 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000023880
Domain Number 1 Region: 124-366
Classification Level Classification E-value
Superfamily vWA-like 1.56e-84
Family Integrin A (or I) domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 624-712
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.57e-22
Family Integrin beta tail domain 0.0011
Further Details:      
 
Domain Number 3 Region: 341-454
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-19
Family Integrin domains 0.0014
Further Details:      
 
Domain Number 4 Region: 10-69
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000173
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 581-622
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000279
Family Integrin beta EGF-like domains 0.0039
Further Details:      
 
Domain Number 6 Region: 540-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family Integrin beta EGF-like domains 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000023880
Domain Number - Region: 506-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0248
Family Integrin beta EGF-like domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000023880   Gene: ENSLAFG00000018167   Transcript: ENSLAFT00000032990
Sequence length 781
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_97:3962845:3989112:1 gene:ENSLAFG00000018167 transcript:ENSLAFT00000032990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLLFLFLTDENRCLKANAKSCGECIQAGPNCGWCTNLTFLQEGMPTSARCDDLEALKKKG
CHPDDIENPRGSKNIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLVLQLRSGEPQTFTLK
FKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMKRITSDFRIGFGSFVEKTVMP
YISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQRISGNLDSPEGGFDA
IMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNVYTMSHYY
DYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIHLIIDA
YNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNK
CPNKNSETIKIKPQGFTEDVEIILQFICECECQSKGIPESPQCHEGNGTFECGACRCNEG
RVGRHCECSTDEVNSEDMDAHCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCE
CDNFNCDRSNGEVCGGNGVCKCRVCECNPNYTGSACECSLDTSSCMAKNGQICNGRGVCE
CGTCKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKEKCADECSHFNLTKVE
NRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVETPECPTGPDIIPIVA
GVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTQENPIYKSPINNFKNPN
Y
Download sequence
Identical sequences G3U7S2
ENSLAFP00000023880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]