SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024133 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024133
Domain Number 1 Region: 83-326
Classification Level Classification E-value
Superfamily vWA-like 3.04e-83
Family Integrin A (or I) domain 0.000000427
Further Details:      
 
Domain Number 2 Region: 297-412
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-19
Family Integrin domains 0.0017
Further Details:      
 
Domain Number 3 Region: 580-657
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.05e-16
Family Integrin beta tail domain 0.0046
Further Details:      
 
Domain Number 4 Region: 496-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 5 Region: 1-42
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000732
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 538-578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000024133
Domain Number - Region: 418-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Integrin beta EGF-like domains 0.036
Further Details:      
 
Domain Number - Region: 461-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0212
Family Integrin beta EGF-like domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024133   Gene: ENSLAFG00000028448   Transcript: ENSLAFT00000028941
Sequence length 740
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_67:12124015:12161977:-1 gene:ENSLAFG00000028448 transcript:ENSLAFT00000028941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPACAWCQKLNFTVRGEPDSVRCDTRNQLLMKGCAADDIVDPRSHAEAQDNQAGGREQLS
PQSVTLYLRPGQAAMFNVTFRRAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLKALND
ITESGRIGFGSFVDKTVLPFVNTHPEKLKNPCPNKEKECQAPFAFRHVLKLTDNSNQFQK
EVGKQLISGNLDAPEGGLDAMMQVAACLEEIGWRNVTRLLVYATDDGFHIAGDGKLGAIL
TPNDGHCHLEDNLYKKSNEFDYPSVGQLAHKLAENNIQPIFAVTKRMVPTYEKLTEIIPK
SAVGELSEDSSNVVQLIKNAYNKLSSRVFLEHSTLPDTLKVTYDSFCSNGVIRLDHHRGD
CDGVQINVPVTFQVKVTATECIQEQSFVIRALGFTDTVTVRVHPQCKCNCHDASSDRSHC
GNKGVVQCGICRCDPGYIGKTCECQTQGRSSQELEGNCRKDNSSVVCSGLGDCFCGECIC
HRADDPKKHIYGPYCECDNFNCERYDGQICGARGICDCGKCQCKQGFEGSACQCPKSTES
CLNVRRVECSGRGRCRCNVCECDPGYQPPLCEECPGCPMPCSRYVSCAECLKFQKGPFGK
NCSEACPGMELKYGFFPNRPCKERDSEGCWITYMLIRRDGKDHYHIQVEETRECVEGPNV
AAIVGGTVAGIVLIGILLLVIWKALTHLSDLREYKRFEKEKLKSQWNNKDNPLFKSATTT
VMNPKSQVAALHKVCLSREG
Download sequence
Identical sequences G3U8H5
ENSLAFP00000024133 ENSLAFP00000024133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]