SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000024945 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000024945
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-18
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000024945   Gene: ENSLAFG00000007041   Transcript: ENSLAFT00000030973
Sequence length 226
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_5:28318090:28325136:-1 gene:ENSLAFG00000007041 transcript:ENSLAFT00000030973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEGVYYCWVQFVSCWQPRWFLLCGGILSYYDSPEDAWKGCKGSIQMAVCEIQVHSVDNTR
MDLIIPGEQYFYLKARSVAERQRWLVALGSAKACLTDSRTQKEKEFAENTENLKTKMSEL
RLYCDLLVQQVDKTKEFEYRGKGNVSPAICNSIEEGIDVGTLLKSTCSTFLKTLEECMQI
ANAAFTSELLYRTPPGSPQLAMLKPSKVKSSLAATGHNEKLKSQES
Download sequence
Identical sequences G3UAT7
ENSLAFP00000024945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]