SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025065 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025065
Domain Number 1 Region: 64-191
Classification Level Classification E-value
Superfamily PH domain-like 8.34e-21
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025065   Gene: ENSLAFG00000005812   Transcript: ENSLAFT00000005809
Sequence length 239
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:1529080:1530075:-1 gene:ENSLAFG00000005812 transcript:ENSLAFT00000005809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRR
QKVELNKEDPTYTVWYLGNAVTLHAKGEGCTDDAVGKIWARCGPGGGTKMKLTLGPHGIR
MQPCERSASGGSGARRPSHAYLLPRITYCTADGRHPRVFAWVYRHQARHKVVLRCHAVLL
ARAHKARTLRLLRQTALAAFSDFKRLQRQSDARHVRQQLCPAGEASAPVSRASGRAALS
Download sequence
Identical sequences G3UB57
ENSLAFP00000025065 ENSLAFP00000025065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]