SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025903 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025903
Domain Number 1 Region: 43-189
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 2 Region: 205-320
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-27
Family DEP domain 0.0035
Further Details:      
 
Domain Number 3 Region: 303-436
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.19e-21
Family DEP domain 0.0033
Further Details:      
 
Domain Number 4 Region: 3-57
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000471
Family DBL homology domain (DH-domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 424-503
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000173
Family PDZ domain 0.028
Further Details:      
 
Domain Number 6 Region: 508-571
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000133
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025903   Gene: ENSLAFG00000004449   Transcript: ENSLAFT00000029508
Sequence length 1459
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_19:47772550:47860212:-1 gene:ENSLAFG00000004449 transcript:ENSLAFT00000029508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LHQELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSN
LTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSL
YIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWL
DAIIREREQRESLKLGMERDAYVMISEKGEKLYHMMMSKKVNLIKDRRRKLSTVPKCFFG
NEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQVMYRFRYDDGTYKAR
SELEDIMSKGVRLYCRLHSLYTPVIKDRDHHLKTYKSVLPGSKLVDWLLAQGDCQTREEA
VALGVGLCNNGFMHHASGKSLLSNAAETFPCEPDHVLVCLGLAVKNKQLRNDFKLVENIL
AKRLLILPQEEDYGFEIEEKNKAVVVKSVQRGSLAEMAGLQVGRKIYSINEDLVFLRPIS
EVESILNQSFCSRRPLRLLVATKAKEVIKVPDQPEALCFQIRGATPPHVYAVGRGSEAAA
AGLCAGQCILKVNGNNVMNEGALDVLEHFQAFRSRREEALGLYQWIYHTHEDAQEARASQ
EAPGEDPSGEGSREEDQPDSAFPLQSLGSQLTLHEDSPMVSLTVDNVHLEHGVVYEYVST
AGVKCHVLEKIVEPRGCFGLAAKILEAFAAEDSVFVQNCGRLMALSSVIMTMPHYEFRNI
CDTKLESITQRIACYQEFAAQLKSRVSPPFKQASLEPHLLCGLDFCPTNCHINLMEVSYP
KTTPSIGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLSATDGDPQG
QGLNDSSFGLTNGALGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINR
LLSTITEPTLGGSCDPPLAEEASSSPLVSEENEMDRADHGGIKKVCFKVSEEDQEDSGHD
TMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRISSDKQDKLHGCL
EHLFNQVDSINALLKGPVMSRAFEETKHFPMDHSLQAEFKQKEEYTIRGRSLIQISIQED
PWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDVELQLRRDAIFCQALVAAVCTFSEQ
LLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDLWE
ALSELDNVAFSFKQLDENYVANTNVFYHIEGSRQALKVVFYLDSYHFSKLPSRLESGASL
RLHTVLFTKALENVEALTPPGSMASEDLQQEINAQSLEKVQQYYRKLRAFYLERSNLPTD
TSTTAVKIDQLIRPINALDELCRLMKSLIHPKPGTSGSLGASLIPISSELCYRLGACQIA
MCSTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILKNLRVKDQMPR
VHRDFFLYCLCQPPVDGDL
Download sequence
Identical sequences G3UDJ5
ENSLAFP00000025903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]