SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000025953 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000025953
Domain Number 1 Region: 24-466
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.22e-73
Family Integrin alpha N-terminal domain 0.00000196
Further Details:      
 
Domain Number 2 Region: 794-1018
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-54
Family Integrin domains 0.00043
Further Details:      
 
Domain Number 3 Region: 466-627
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-30
Family Integrin domains 0.001
Further Details:      
 
Domain Number 4 Region: 629-791
Classification Level Classification E-value
Superfamily Integrin domains 1.26e-27
Family Integrin domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000025953   Gene: ENSLAFG00000004724   Transcript: ENSLAFT00000025999
Sequence length 1073
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_3:54793780:54875037:-1 gene:ENSLAFG00000004724 transcript:ENSLAFT00000025999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGQLWLLYLSAGLLSLLCAAFNLDTREDYVIQKLGDPESLFGFSLAMHWQLQPEDKR
LLLVGAPQAKALPLQRANRTGGLYSCDITSQEPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GENNHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSTH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRGGEVGGAVYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDGMGKVFIYHGSANGINTK
PTQVLKGRSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTVFRARPVINIQKTITVTPDK
IDLSKKMSCAAPSGICLKVKACFEYTAKPTGYNPSIVIVGTLEAEKERRKSGLSSRVQIR
NQGSEPKYSQQLILSRQKQKACMDETLWLQENIRDKLRPIPITASVEIQESGSRRRVNSL
PEIPPILNSNEPKTVHADVHFLKEGCGSDNVCNSNLKLEYKFCTREGSQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTNDGDDAHEAKLIATFPDTLTYSAYRELRSFP
EKQLSCVANQNGSQADCELGNPFKRNSNVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLASITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFSVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKIGCEPPSEINFLKLKESHNSRK
KREIAEKQIDDRRKFSLFAERKYQTLNCSVNVKCVNIKCPLQGLDSKASVILRSRLWNST
FLEEYSKMNYLDILTRASIDVTAAAENIKLPNAGTQVRVTVFPSKTAAQYSGVSWWIILV
AILAGILMLGLLVFLLWKCGFFRRNKKDHYDATYHKAEIHAQPSDKERLTSDA
Download sequence
Identical sequences G3UDP5
XP_010601128.1.64505 ENSLAFP00000025953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]