SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026053 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026053
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.33e-32
Family Ubiquitin-related 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026053   Gene: ENSLAFG00000025811   Transcript: ENSLAFT00000034198
Sequence length 95
Comment pep:novel supercontig:loxAfr3:scaffold_49:7263985:7274244:1 gene:ENSLAFG00000025811 transcript:ENSLAFT00000034198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVF
Download sequence
Identical sequences G3UDZ5
XP_003417316.1.64505 XP_006869651.1.41390 XP_007957852.1.48129 XP_021068754.1.100879 ENSLAFP00000026053 ENSLAFP00000026053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]