SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026090 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026090
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-34
Family Pleckstrin-homology domain (PH domain) 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026090   Gene: ENSLAFG00000007609   Transcript: ENSLAFT00000026641
Sequence length 1170
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_21:32641018:32712232:1 gene:ENSLAFG00000007609 transcript:ENSLAFT00000026641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKQERNQRPSSMVSETSTAGTTSTLEARPGPKIIKSINKVHSFGKRDQAIRRNPNVPVV
VRGWLHKQDSSGMRLWKRRWFVLADYCLFYYKVKDSREEAVLGSIPLPSYVVSPVTPEDR
ISRKYSFKAEHSGMRTYYFSADTLEDMNAWVRAMNQAAQVLSRSSLKRSPSPSRDADVEK
VERQAVPQANHTDACRECGRVGPRHARDCPHRGHDDSYGFERQEQEEEGYRSQRDPLEGK
RDRSKARSPYVSAEEDALFVDLPGGSRGQQAQPQRAEKNGMLPASYGPGEQNETGGYQRA
FPPRTNSEKHSQKKSSLAQVEHWAKASKGDGRSLPSEQTLPRQGPSQPLSFPENYQTVPK
NTRHPSGSSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHG
SPTAPICAGSPEFTDQGRSRSMLEVPRSISVPPSPSDIPPPGPPRAFPPRRPHTPAERVT
VKPPDQICFPAAWKAGKDVCVRSAQLLVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQL
KKDLEYLDLKIKNNEPLINVLYKVLKKSARGCRPRRSLVAVVHVFCDGVYTLKIAESDID
VKLSVFCEQDRILQDSEDKIRALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAYQQRL
LQEDLVHIRAELSRESTEMENAWNEYLKLESDVEQLRQTLQEQHRRAFFFQVEKSQIQKD
LWRIEDVIAGLSANKNSWGNRTSQRPKGVLSPEQLMSSIYPAICLLSTVPVLRIATPNSP
PSNSLSSDTGSGSFSEQEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKR
QSDERKRDRELGQCVNGDSKPLQAGLLGGCHQLGYLVPSRGQEAEGHKEVFMAPVGYVTS
SPPHCLTGLWPELAPGRLGKQPSCSICNSPSHPLQRPKSALERLYSGDHQRGKMSAEEQL
ERMKRHQKALVRERKRTLSQAQTPKGQEVTALNPLVCCQWKREQDFDLQLLERAMQGERK
DKEENGWLKLQAMPVTELDLEPQDYDLDISRELSKPEKVAIPERYVELDPEEPPSLEELQ
ARYRKAEKIRSILTRSSVSNLQSAASQDQNSVADLDSQLQEQERIINISYALASEASQRS
KQVAAQQLVLLPPKAPLSSRPTPPYPPLSN
Download sequence
Identical sequences G3UE32
ENSLAFP00000026090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]