SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026209 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026209
Domain Number 1 Region: 520-892
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.14e-123
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 16-125
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-18
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026209   Gene: ENSLAFG00000016197   Transcript: ENSLAFT00000027479
Sequence length 894
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_5:33712808:33787361:1 gene:ENSLAFG00000016197 transcript:ENSLAFT00000027479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQDSWEVVEGLRGEMNYTQEPPIQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDI
EREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEDGFDEWVSKLRHHRMYRQN
EIAMFPREVNHLFSGSTVTDSASGTLDSISSRKSVEQRSSISKQNAFQTGSNLSFSCGGE
TRVPLWLQSSEDMEKCSKDLAHCHSCLAEMSQLLQNMDVLHRTYSAPAINAIQGGAFESP
KKEKRSHRRWRSRAIGKDAKGTLQEASAGSFVESLSYKTLFSYYSPFVPKPPSGPLRLHS
SNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNSISMERDRLKH
LMEQDITSSPSAQVIGLKHALSSALAQNTDLKERLRRIHAESLVLDHLAVAKLGDSLAEV
GKENSRDENRALVHQLSNESRLSLADSLSEFFDAQEVLLSPSSSENEISEDDSYVSDISD
NLSLDNLSNDLDNERQTLGGSQEGKWQSGKRTCLPAPCPNTGNISLWGILRDNIGKDLSK
VAMPVALNEPLNTLQRLCEELEYSELLDKAAQIPNPLERMVYVAAFAVSAYASSYFRAGS
KPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACRAESGNFVFWQDVRWKNKFWGKSM
EIVPIGTTHVTLPVFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLSDDSCHCKVNF
IKAKYWSTNPHEIEGTVFDRSGKAVHRLFGKWHESIYCGGPSSSTCVWRANPMPKGYEQY
YGFTQFALELNEVDPFSRSLLPPTDTRFRPDQRFLEEGNLEEAEIQKQRIEQLQRERRRV
LEENNLEHQPRFFSKKVVLKNRLKSDDDSWVSNGTYLELRKDLGFSKLDHPVLW
Download sequence
Identical sequences G3UEF1
ENSLAFP00000026209 ENSLAFP00000026209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]