SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026252 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026252
Domain Number 1 Region: 7-126,318-628
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.27e-68
Family Integrin alpha N-terminal domain 0.0000702
Further Details:      
 
Domain Number 2 Region: 146-341
Classification Level Classification E-value
Superfamily vWA-like 8.01e-46
Family Integrin A (or I) domain 0.00000345
Further Details:      
 
Domain Number 3 Region: 628-775
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-25
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 4 Region: 776-789,818-935
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-21
Family Integrin domains 0.0053
Further Details:      
 
Domain Number 5 Region: 970-1083
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000837
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026252   Gene: ENSLAFG00000029411   Transcript: ENSLAFT00000026387
Sequence length 1173
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_127:1446285:1458715:-1 gene:ENSLAFG00000029411 transcript:ENSLAFT00000026387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGLCSPFNLDVHHPRLFPGPPEAEFGYSVLQHVAGGRRWMLVGAPWDGPSGDRRGDVYRC
PVGGSLNAPCAKGHLGDYPLGNSSHPAVNMHLGMSLLETDGVGGFMACAPLWSRACGSSV
FSSGICACVDDSFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIYPWSEVQTFLRRLVRRLF
IDPEQIQVGLVQYGESTVHEWSLGDFRTKEEVVRAARNLSRREGRETKTAQAIMVACTEG
FSQSRGGRPEAARLLVVVTDGESHDGEELPEALKACEAGRVTRYGIAVLGHYLRRQRDPS
SFLQEIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGSHGENESSFGLEMSQIG
FSTHRLKDGILFGMVGAYDWGGSVLWVEKGHHLFPPRTALEDEFPPALQNHAAYLGYSVS
SMLLQGGRRLFISGAPRFKHRGKVIAFQLKKDGAVRVAQSLQGEQIGSYFGSELCPLDTD
GDGTTDVLLVAAPMFLGPLNKETGRVYVYLVGQQPLLMLRGKLQPEPPQDARFGFAMSAL
PDLNQDGFADVAVGAPLEDGHRGALYLYHGTQSGVRSHPAQRIAAVSMPQALSYFGRSVD
GRLDLDGDDLVDVAVGAQGAAILLSSRPIIHLTPSLTVTPPAISVVQRNCRRRGQEAACL
TADLCFQVTSHTPGRWTRQFYMRFTASLDEWTAGARAAFDGTGQRMSPRRLRLSVGNVTC
EQLHFHVLDASDYLRPVALTVTFALDNTTKPGPVLDEGSPTSIRKLVPFSKDCGPDNECV
TDLVLRANMDIRGSRIIEVKLLAPLQLLGSPFSTTPRKAPFVVRGGRRKVLVSATLENRK
ENAYNTSLSLSFSRNLHLASLTPQRDSPVKVECAAPSSHAQLCSVGHPVFQSGAKVTFLL
EFEFSCSALLSQVLVRLIATSNSLETDGTLQDNTAQASVYIQYEPHLLFSSESTLHRYEV
HPYGTLPVGSGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASC
TVQNLTEPPQAPVDPEELQHTSRLNESNTRCQVVRCHLGRLAKGTEISIGLLRLVHNEFF
RRVSPSLSTTLPFCSYLELYTTFFEKFKIPGIQSLLEVIQTHPVLISLWILIGSILGGLL
LLALLVFCLWKLGFFAQEGSRKPSLAASPKDLQ
Download sequence
Identical sequences G3UEJ4
ENSLAFP00000026252 ENSLAFP00000023466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]