SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026292 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026292
Domain Number 1 Region: 327-401
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000471
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 125-203
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000883
Family Rhamnogalacturonase B, RhgB, middle domain 0.02
Further Details:      
 
Domain Number 3 Region: 962-1051
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000165
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 4 Region: 881-952
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00001
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000026292
Domain Number - Region: 213-297
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00471
Family Rhamnogalacturonase B, RhgB, middle domain 0.023
Further Details:      
 
Domain Number - Region: 440-488
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00589
Family Carboxypeptidase regulatory domain 0.019
Further Details:      
 
Domain Number - Region: 808-866
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00706
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 49-112
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0322
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026292   Gene: ENSLAFG00000029647   Transcript: ENSLAFT00000025665
Sequence length 1220
Comment pep:novel supercontig:loxAfr3:scaffold_124:1247662:1311231:-1 gene:ENSLAFG00000029647 transcript:ENSLAFT00000025665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAGWMVGPPRPVVVAAVLLLSCVGLARGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKH
GTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTNVELYVDGVNDICTKGGDI
NFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYE
ILATHPTWALKEASTTVRVTNSNANVANPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSVV
SKEDVLGCNVSPVPGFQPQDENLVYLCYVVSKEDGSFSFYSLPSGGYTVVPFYRGERITF
DVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGEGVPEAVVTLNNQIKVKTKAD
GSFRLENITTGTYTIHAQKEHLYFETITIKIAPNTPQLADIIATGFSVCGQISIMRFPDT
VKQMSKYRVVLSSQDRDKSLVTVETDAHGSFCFKAKPGIYNVQVIVPEVETRAGLTLKPH
TFPLVVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNS
MTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEEDVSAIEFRQTGYMLRCSLSHAITL
EFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLT
AIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIESRRQERE
KNGKEEGGEGMTIPPVQEMVDELQGPFSYDFSYWARSGEKITVIPSSKELLFYPPSMEAV
VNGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSVGP
LHSDLEYTVASQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGGVF
RSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYS
CYGTVSSLNGEPEQGVAVEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEG
NDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKSEN
LDNPIQTVSLGQSLFFHFPPLLRDSENYVVLLDSTLPRSQYDYVLPQVSFTAVGYHKHIT
LIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQTAS
DNSGPEDAKRQAKKQKTRRT
Download sequence
Identical sequences G3UEN4
ENSLAFP00000026292 XP_003421926.1.64505 ENSLAFP00000026292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]