SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026409 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026409
Domain Number 1 Region: 1-334
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.5e-84
Family Integrin alpha N-terminal domain 0.00000000000564
Further Details:      
 
Domain Number 2 Region: 635-868
Classification Level Classification E-value
Superfamily Integrin domains 2.09e-64
Family Integrin domains 0.00000000335
Further Details:      
 
Domain Number 3 Region: 335-494
Classification Level Classification E-value
Superfamily Integrin domains 3.87e-46
Family Integrin domains 0.0000000462
Further Details:      
 
Domain Number 4 Region: 495-628
Classification Level Classification E-value
Superfamily Integrin domains 4.97e-37
Family Integrin domains 0.000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026409   Gene: ENSLAFG00000004362   Transcript: ENSLAFT00000037315
Sequence length 915
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_3:40555835:40607811:-1 gene:ENSLAFG00000004362 transcript:ENSLAFT00000037315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDADGQGFCQGGFSIDFTKA
DRVLLGGPGSFYWQGKLISDQVAEIVSKYDPKVYSIKYNNQLATRTAQAIFDDSYLGYSV
AVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGEQMAAYFGFSVAATDIN
GDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAP
LGDLDQDGYNATDIAIAAPYGGEDKKGVVYIFNGRSTGLHVVPSQILEGQWAARSMPPSF
GYSMKGATDIDRNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVYPSILNQDNKTCPLP
GTSLKVSCFNVRFCLKADGKGALPRMLNFQVELLLDKLKQKGAIRRALFLHNRSPGHSKN
MTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRMAADTTGLQPILNQFTPA
NISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELI
VSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQ
SEMDTSVKFDLQIQSSNLFDKVSPMVSYKADLAVLAAVEIRGVSSPDHIFLPIPNWELKE
NPETEEDVGPVVQHIYELRNNGPSSFSKAMLSLQWPYKYNNNTLLYILQYDIDGPMNCTS
DMEINPLRIKPVSTSQTTEKNDTIAGQGDRNHLITKRDLTLSEGDVHTLTEIKGCGIAEC
LKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIE
DIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVLVMYRMGFFKRVRPPQE
EQEREQLQPQENGEG
Download sequence
Identical sequences G3UF01
ENSLAFP00000026409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]