SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026418 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026418
Domain Number 1 Region: 54-108,170-313
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-41
Family Pleckstrin-homology domain (PH domain) 0.0044
Further Details:      
 
Domain Number 2 Region: 6-75,106-132
Classification Level Classification E-value
Superfamily EF-hand 0.0000000646
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026418   Gene: ENSLAFG00000007975   Transcript: ENSLAFT00000025493
Sequence length 627
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_105:556223:575210:-1 gene:ENSLAFG00000007975 transcript:ENSLAFT00000025493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYWLDSNGTSLLSNQDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVGLGELEELLAQEAQAAQTTGGLS
VWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQL
QPSCLCYFASEECKEKRGTIPLDQHCCVEVLPDREGKRCMFCVKTASRTYEMSASDTRQR
QEWTAAIQTAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERK
LQELELLQEAQRQAERLLQEEEERRRSQHRELQQALECQLREAEQARASMQAEMELKKEE
AARQRQRIEELEEMQQRLQEALQLEVKARRDEEAVRLAQTRLLEEEEEKLKQLLQLKEEQ
ERYIERAQQEKQELQQEMAQQSRSLQEAQEQLEEVRQNRQRADEDVEGCPTKLRQASTNV
KHWNVQMNRLMHPIAPGDKRPTSSSSFTGFQAPLLARRDSSLKRLTRWGSQGNRTPSPIS
SERQKSLNGGDEPSIPTSTPQEDKLDP
Download sequence
Identical sequences G3UF10
ENSLAFP00000026418 ENSLAFP00000026418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]