SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026476 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026476
Domain Number 1 Region: 268-400,701-876
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-50
Family Diacylglycerol kinase-like 0.02
Further Details:      
 
Domain Number 2 Region: 3-124
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-29
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 110-166
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0087
Further Details:      
 
Domain Number 4 Region: 170-223
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026476   Gene: ENSLAFG00000009623   Transcript: ENSLAFT00000028281
Sequence length 1098
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_23:20996431:21108113:1 gene:ENSLAFG00000009623 transcript:ENSLAFT00000028281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEASTKNA
NNSFTIITPFRRLMLCADNRKEMEDWISCLKSVQTRETYEVAQFNVEHFSGMHNWYACSH
ARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRAINNCKWTTLASIGKDIIEDEDG
VAMPHQWLEGNLPVSAKCVVCDKTCGSVLRLQDWKCLWCKAMVRYVNIKHIPICGVGGQG
GKKLYMLTLPCVFFSGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFD
LMNGGPYLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLIKQAMGVLPLGTGNDLAR
VLGWGGSCDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPTKAPLLPGPPGQSAGFYM
TIYEDSVATHLKTILNTDEHAVIVSAANILCETIKDFVAKVEKEYGKTLENPVEADAMAS
KCSVLNEKLEQLLQALHTEAQELPLTPGVRPVIVEEGPGESSSEESLCESKEQLADDVTS
SQKAVKPTEIMLRANSLKKAVRQVIEQAKKATDEQIVHPCEPVNQSPECDSTEIADPKEE
AKDDDAKEALPVKTAPRSPDYRTSHSSFQTEPSSSGPAPAACKESLPVLNTRIICPGLRA
GLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSLDGYTEKCVMNNYFGIGLDAKISLE
FNNKREEHPEKCRSRTKNFMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQGIA
VLNIPSYAGGTNFWGGTKEDDMFTAPSFDDKILEVVAIFDSVQMAVSRVIKLQHHRIAQC
RAVKITIFGDEGLPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKYD
SGKPVIRTHLYIHHAVDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVNA
CSHALNKANPKYPESLTRDIATEIAMNVKALHNETESLLVGRVPLQLESPHEERVSDALH
SVEVELQKLTEIPWLYYIFHQNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVPKQKTSSQ
HGPRDTESGSCETNSPGN
Download sequence
Identical sequences G3UF68
ENSLAFP00000026476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]