SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000026516 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000026516
Domain Number 1 Region: 303-517
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-51
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 819-1118
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000047
Family WD40-repeat 0.031
Further Details:      
 
Domain Number 3 Region: 530-613,707-765
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000344
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000026516   Gene: ENSLAFG00000000409   Transcript: ENSLAFT00000035351
Sequence length 1276
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:5018694:5144469:-1 gene:ENSLAFG00000000409 transcript:ENSLAFT00000035351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSSSLLLIPSPGDQLVPRAPGPSPEVEDDPGEAFEFDDSDDEEDTSTGLAVPSVAAGK
ETDSPLVCFDSAPITDPDPAAAPPQTEVPAVVSNGDAVDTAFSGVRRSTWKGKSSHRIER
FTFPALEEDVIYDDVPCENLDAHQPGAERNLEDAHRDGSPRVADDLGWSSSEFESYSEDS
GEEAKLEAEPAKHRVSFQPKLSPDLTRLKERYARTKRDILALKVGGRDMQELKHKYDCKM
TQLMKAAKSGTKDGLEKTRIAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVSDIKPLAPEL
GPMPDGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDYRNPLMEMEPKVLSVRKCQLVF
FRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTNAMSI
IKKACLTKPAFLEFLKRRQICSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGHPDR
LSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLCETL
TETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPTNHRGQLEISSLVPLGPKYVVKWNT
ALPQVQVVEVGQEGGAYDKDNMLIQHAGAKKTSAAGQAQNKVYLGPPRLFQELQDLQKDL
AVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPGKPD
KSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLCPDEDKKSKAPFWCPIL
ACCVPAFCSRALSLQLGALVHSPVNSPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVDIFS
LNRPSPRTVKSFPLAAPVLCMEYIPEPEEEGESRDESRTAADPSAAVHPTICLGLQDGSV
LVYGSVDTGTQCLATCRKPRPAACALSAHSPFHLFAGLQDGTLAAYPRTSGGVPWDLESP
PVCLTVGPGPVRTLLSLEDAVWASCGPRVTVLDATTLQTQQSFEAHQDEAVSVTHMVKAG
SGVWMAFSSGSSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCVTSLLICQGLLWVGTD
QGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVATSILAPDILRSDQEEAEGSRA
EEDKPDGQPHEPAPAPAPESHVGRELTRKKGILLQYRLRSTAHLPGPLLSVREPGPTDGA
ALEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSMAIISGGQGYRNFGGGGRLAPC
GDTDSTLLIWQVPLTL
Download sequence
Identical sequences G3UFA8
ENSLAFP00000026516 ENSLAFP00000000349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]