SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027044 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027044
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily Histone-fold 1.29e-29
Family Nucleosome core histones 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027044   Gene: ENSLAFG00000026521   Transcript: ENSLAFT00000033504
Sequence length 136
Comment pep:novel supercontig:loxAfr3:scaffold_65:8471392:8471819:-1 gene:ENSLAFG00000026521 transcript:ENSLAFT00000033504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKRRHRNCHRRRKRVNSRCAQARLRFPKSCMNHLLREGHYSHRLSSSTPDFLAAILEY
LISSILELADNEARNDCRKRITPQDVDMAVCNHPELSRLFRNASISQQEELMIPGFQSLP
GVLEASSQNQNFSQLR
Download sequence
Identical sequences G3UGT6
ENSLAFP00000027044 ENSLAFP00000027044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]