SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027113 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027113
Domain Number 1 Region: 34-178
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-36
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027113   Gene: ENSLAFG00000010379   Transcript: ENSLAFT00000027901
Sequence length 661
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_13:8901551:8931908:-1 gene:ENSLAFG00000010379 transcript:ENSLAFT00000027901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKTGGKRPAITNSDISNHNMVSEVPPERPSVRVTRTSRKAITFGKRSHSMKRNPTAPV
TKAGWLFKQASSGVKQWNKRWFVLVDRCLFYYKDEKEESTLGSIPLLSFRVAAVQPSDNI
SRKHTFKVTVCWVDEAGATSTHCLSPQAEHAGVRTYFFSAESPEEQEAWIQAMGEAARVQ
IPPAQKSAPQAVRHNHEKPDSENIPPSKHHHQPQHNSLPKPEPEAKTRGEGDGRGCEKAE
RRPERPEVKKEPLVKANGIQPGPEPASEPGSPYPEGPRVPGGVEQAAQPNGWQYSSPSRP
GSTAFPPQDGESGGHRRSFPPRTNPDKIAQRKSSMNQLQQWVNLRRGVSQPSEDLRSPSR
FYPVSRRVPEYYGPYSPQYPDDYQYYPAGVRPDSICSMPAYDRISPPWALEDKRHSFRNG
SGPAYQLREWKEPTGYGRQDGTAWIPSPSRQPVYYDELDAASSSLRRLSLQPRSHSVPRS
PSQGSYSRARIYSPARSPSSRFERLPPRSEDVYADTNAYVMRRSISSPKVPSYSEVFRDS
LHTFKLNEQDTDKLLGKLCEQNKVVREQDQLVQQLRAEKESLESALMGTHQELEMFGNQP
AYPEKLLHKKESLQNQLINIRVELSQATTALTNSTVEYENLESEVSALHDDLWEQLNLDT
Q
Download sequence
Identical sequences G3UH05
ENSLAFP00000027113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]