SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027189 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027189
Domain Number 1 Region: 185-453
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-84
Family Nuclear receptor ligand-binding domain 0.00000000324
Further Details:      
 
Domain Number 2 Region: 132-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.11e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027189   Gene: ENSLAFG00000008059   Transcript: ENSLAFT00000031080
Sequence length 459
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:16201415:16246919:-1 gene:ENSLAFG00000008059 transcript:ENSLAFT00000031080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYGARYVHLGFTGSPGHTGSTSMSPSAVLSTGKSMDNHLSYTDTPVSAPRTLSAVGAPLN
ALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNNVSSSEDIKPLPGLPGIGNM
NYLSTSPGPLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLID
KRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAESASNGHEDMPVERILEAEL
AVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRA
GWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMD
KSELGCLRAIVLFNPDAKGLSNPSEVEALREKVYATLEAYTKQKYPEQPGRFAKLLLRLP
ALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences G3UH81
ENSLAFP00000027189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]