SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000027361 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000027361
Domain Number 1 Region: 243-333
Classification Level Classification E-value
Superfamily Immunoglobulin 6.93e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 161-220
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000288
Family Pre-dockerin domain 0.045
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000027361
Domain Number - Region: 427-477
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0235
Family Carboxypeptidase regulatory domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000027361   Gene: ENSLAFG00000025674   Transcript: ENSLAFT00000029607
Sequence length 1103
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_26:22737753:22743556:-1 gene:ENSLAFG00000025674 transcript:ENSLAFT00000029607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EWTSWFNVDHPGGDGDFESLAAIRFYYGPARVCPQPLALEARTTDWALPATVGERVHLNP
TRGFWCLNREQPRGRRCSNYHVRFRCPLGLCSINMFWQPWACGAVVGNRGIGKGERSSEP
KTWSLAGPPAPAWISSFGAPLPCCSLCPPGCNPDTCGCPNHVLLGVVVTRSGRPLPGARV
FLRGQPGTLATSDAHGTFRVPGICASSQANISAQVDGFSAGVAQAQANSSFSAVVTIVLK
KLGKPYLMKHPESRVREAGQNVTFCCKAAGTPTPKKYSWFHNGTLLDRRELGYGAQLELR
GLRLDQAGTYHCKAWNDVGTIRSATAWLTVLAPGQPACDPKPLEHLIKLPDDCGQPDGSP
AYLDVGRCPDVRCPGPMVSGPRCGDTSTRCCSVQRLQSRAVHCSGYVLPVKVVAECGCKK
CLPPRALIRGRVVAADSGEPLRFARILRGHEPIGFTSYQGDFTIEAPPSPERLVLTFLDP
SGEFVDAIRVLPFDPWGTSVYHEVKAMRKRLPVILDATQSNRIPLGELRDQAPMGELVLP
PGAFRFADGRPYMGAVEARVTFVDPRDLASAAAAPSDLRFLDRDGELVPLRTYGMFSVDL
RASSSGEQLQAGPMAVRVAAGQIHMAGHAEALRLWSLDPSTGLWEEESHFQREVPAGRRV
RREERVFLVGNVEVRERRLFNLDVPERRRCFVKVRVYANDKFTPSEQVEGAVVTLVNLEP
APGFSANPRAWGRFDSAVTGPNGACIPAFCDEEQPDAYTALVTATLGGEELEPPPSRPRP
LPSAVGVTQPYLDRLDYRRTDHEDPAFKRNGFRINLAKPRPGNSAEARGPVYPWRSLREC
QGAPVTDSHFRFARVEADRYEYNVVPFREGAPASWTGDFLSWWPNPQEFRACFLKVRIQG
PQEYMVRAHSAGGSHPRTQGQLYGLRDARSVRDPQQPGTSAACVEFKCSGMLFDQQQVDR
TLVTITPQGSCRRMAINTLLRDYLARHPPPAPIDDPTTFSMLAPLDPLGHNYGVYTVTDQ
SPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPPTGRPSLFQRLLESPAAALG
DIRREMGEVARGQARATGSLRTR
Download sequence
Identical sequences G3UHQ3
ENSLAFP00000027361 ENSLAFP00000027361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]