SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028010 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028010
Domain Number 1 Region: 624-786
Classification Level Classification E-value
Superfamily PH domain-like 5.62e-55
Family Pleckstrin-homology domain (PH domain) 0.0000147
Further Details:      
 
Domain Number 2 Region: 414-627
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-53
Family DBL homology domain (DH-domain) 0.0000000949
Further Details:      
 
Domain Number 3 Region: 189-298
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000253
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028010   Gene: ENSLAFG00000014023   Transcript: ENSLAFT00000027530
Sequence length 1025
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:2376776:2483700:-1 gene:ENSLAFG00000014023 transcript:ENSLAFT00000027530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGVLSVSSF
HALICSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKEKRPSITQVDELLPIY
GSTADGVRRDSTWETQAYVHFQDNQGVTVMIKPEHRVEDILTLACKMRQLEPSHYGLRLR
KLVDENSEWYSPTLHEYMQDQAYEEIEIFPLNVRAVQLAKTGSVPDFGFAVTAQVDEHQH
LSRIFISDVLPDGLAYGEGLRKGNEIVTLNGEAVADLNLKQMEALFSEKSVGLTLVARPL
DAKRTLGTSWSDSDLFSTDQKRLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKR
SQTDGTLDQVSHREKMEQTFRSAEQIAALCRGFTDTQTGDMEAPRESRDAPPRPLARHLS
DADRLRKVIQELVDTEKSYVKDLSCLFELYLEPLQSETFLTQDEMESLFGSLPEMLEFQK
VFLETLEDGISASSDFNTLETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVL
ERAKTDQAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYH
LTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKELAESSPFRLGPHENFSWR
LARLVEGRIEKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHGSADLDPFKFRWLI
PLSALQVRLGNTAGTENNSLWELIHTKSEVEGRPETTFQLCCSDCESKTNIVKVIRSILR
ENFRRHIKCDLPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLRNSSSSEGMGEPSKGTS
LDSDDGSLGSSTQSSGCHTAESRQDSKSASPVKCPPASLSEFSDSLIKESDILSDEEDDY
QPALKRGSPTKDIEIQFQRLRISEEPDARPAGQPPGTQAREGQQGGEHPKLIRGHFCPIK
RKANSTKRDRGTLLKSQVRHQSLDSQSENAHIDINSVLQREFSVQSLTSVVNEECFYEAE
GHGKS
Download sequence
Identical sequences G3UJK1
ENSLAFP00000028010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]