SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028168 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028168
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 6.77e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.068
Further Details:      
 
Domain Number 2 Region: 285-351,511-716
Classification Level Classification E-value
Superfamily ARM repeat 0.00000691
Family RPA1889-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028168   Gene: ENSLAFG00000017825   Transcript: ENSLAFT00000035416
Sequence length 821
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_52:6394154:6459159:1 gene:ENSLAFG00000017825 transcript:ENSLAFT00000035416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEE
RFEEMPETSHLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQ
ACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHRE
FLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKV
EIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLA
KLGILPALEIVMGLEDVSRTPWRFGSLSYKTKLWERKKRKKKRQEAQQSDDDILLINVII
EQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLA
NTSEDKYEKVDNIVGSNKNNTVCPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDL
LRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVVNALLDNGTRYNL
LNSAVVELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDRQNQKLN
SVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKSKPEDDFPDSYEKFMET
KKAKESEDKENLPKRTSSGGFKFTFSHSASAANGTNSANSKSVVAPTSPASSNGSSSKTT
GLAASVTASKGSLVGLVDYPDDEEEDEEEETSPRKRPRLGS
Download sequence
Identical sequences G3UK09
ENSLAFP00000028168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]