SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028427 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028427
Domain Number 1 Region: 70-118
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000392
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000028427
Domain Number - Region: 42-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000235
Family Somatomedin B domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028427   Gene: ENSLAFG00000027349   Transcript: ENSLAFT00000028232
Sequence length 261
Comment pep:novel supercontig:loxAfr3:scaffold_19:48409136:48428773:1 gene:ENSLAFG00000027349 transcript:ENSLAFT00000028232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALAAVAVGAWAQGLPGSLSPGQGCAALGRCCPGRDPNCAARGSPRCFCDQACGAARDCC
ADYARVCPAVPCVVAEWSDWSRCAKPCQVSYRVRQRHILQEPRNGGAPCPPLEEQAGCME
YWSRQGVECQQSLLPALITTGRYGKERKKRGVPKEQETHLRDCWYCVQFRLGPIPGSCRQ
VRAPHAQWMRYLTQGHTVCVRCEWPAQDTRSQRCYGDGGGAGGNQLLVWQAAGHAQCRGS
WERLRQLQDCTCPAVHSLVFI
Download sequence
Identical sequences G3UKR8
ENSLAFP00000028427 ENSLAFP00000028427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]