SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028552 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028552
Domain Number 1 Region: 47-109
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-20
Family Phosphotyrosine-binding domain (PTB) 0.001
Further Details:      
 
Domain Number 2 Region: 469-548
Classification Level Classification E-value
Superfamily SH3-domain 1.25e-17
Family SH3-domain 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000028552
Domain Number - Region: 605-664
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0691
Family SAM (sterile alpha motif) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028552   Gene: ENSLAFG00000030898   Transcript: ENSLAFT00000025871
Sequence length 691
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_227:227771:247942:1 gene:ENSLAFG00000030898 transcript:ENSLAFT00000025871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQSGSGSSCPGAANGSLGRSDGVAKMSAKDLFEQRKRYSNSNVIMHETSQYHVQHLATF
IMDKSEAIVSVEDAIRKLVQLSSKEKIWTQEMLLQVNDKTLRLLDIGSQVRGGGSFRAPR
VRGGPTKGQVLKDCGPSTLVAVVHILALHFLSPKVIFPSVSLVRGACRFARANQVSQGEG
RQGRPDPMPEHNPTALWFGGASLVIPLEQQAVPPFAPQASAVGNSLEEGAAGSLAQKIEK
ETQILNCALDDIEWFVARLQKAAEAFKQLNQRKIPAPGPWVLTAQRPPRPRPLGADGPAP
SPPRALAKLKKHIQNPSAAELLHFLFGPLDLIVSTCGSPDIARSVSSPLLSRDAVGFLRG
HLVPKEMALWETLGETWTRPRSEWPREPQMLLYVLSSISAGEPPDVLQKLPEGGGLAAVP
SDEPTPVSRLSFRNTPKHSLTSEPTPPGDVLPPAGSPHAHRRYDPLPTMGKYVKILYDFT
ARNANELSVLKDEVLEVLEDGRQWWKLRNRSGQAGYVPCNILDEIQPEEAGATLEQASLQ
YWGPASPTHKLPANFAGNKDELIHHMDEVNDELVRRISNTKAQPQRHFRVERSQPVNLPL
TFESSPNEVRAWLEAKAFSPRTVDHLGILTALQLFSLNKEELKKVCGEEGIRVYSQLTVQ
KAFLEKQQGGSELQELMNKFHSKNQRRMEDS
Download sequence
Identical sequences G3UL43
ENSLAFP00000028552 ENSLAFP00000028552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]