SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028622 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028622
Domain Number 1 Region: 134-160,188-403
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-61
Family Nuclear receptor ligand-binding domain 0.00000000542
Further Details:      
 
Domain Number 2 Region: 81-166
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028622   Gene: ENSLAFG00000026176   Transcript: ENSLAFT00000029340
Sequence length 403
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_71:5162239:5167815:-1 gene:ENSLAFG00000026176 transcript:ENSLAFT00000029340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTSAMSSQVVGIEPLYIKAEPASPDSPKGSSETEPEPPVALAPGPAPTRCLPGHKEEED
GEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSC
PASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGP
FPAGPLAVAGGPRKSAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREI
VVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEG
ARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALH
EALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHF
Download sequence
Identical sequences G3ULB3
ENSLAFP00000028622 ENSLAFP00000028622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]