SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028633 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028633
Domain Number 1 Region: 214-366
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 2.62e-63
Family C-terminal domain of adenylylcyclase associated protein 0.000000348
Further Details:      
 
Domain Number 2 Region: 3-136
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 2.48e-54
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028633   Gene: ENSLAFG00000011419   Transcript: ENSLAFT00000034228
Sequence length 368
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_44:10706818:10759486:-1 gene:ENSLAFG00000011419 transcript:ENSLAFT00000034228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHDVAALLKPISEKIQEIQTFRERNRGSSMFNHLSAVSESIPALGWIAVSPKPGPYVKEM
NDAATFYTNRVLKDYKHSDLRHVDWVKSYLNIWNELQAYIKEHHTTGLTWSKTGPVASTA
SVLSAFSPGPGPGPPPLFDNEGRKEESSPSRSALFAQLNQGEAITKGLRHVTDDQMTHKN
PSLRAQGGQTRSPTKSLTPSPTSPKSHPPQKHVPVFELEGKKWRVEYQEDRNDLMVADTQ
LKQVAYIFKCNKSTLQMKGKINSITIDNCKKFGLVFDNVVGIVEVINSKDIQIQVMGRVP
TISINKTEGCHIYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPVPEQFKTIWDGSKLI
TEPAEIMA
Download sequence
Identical sequences G3ULC4
ENSLAFP00000028633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]