SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028700 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028700
Domain Number 1 Region: 2-136
Classification Level Classification E-value
Superfamily PH domain-like 2e-37
Family Ran-binding domain 0.00000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028700   Gene: ENSLAFG00000028130   Transcript: ENSLAFT00000037075
Sequence length 175
Comment pep:novel supercontig:loxAfr3:scaffold_22:894043:894837:-1 gene:ENSLAFG00000028130 transcript:ENSLAFT00000037075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESQVEPIVSLPGQEIKILEEDEEELLKMQAKLYCFAPENKLPEWKEWGTSDMKLLRPKEK
GRIHLLKHRDKTLKIYANHYITPRKASSNRAWVWNIHTNFPDECPKPELLAIQFLNAENA
QKFITKFEECRKEIEERGKKGLGKSENAEKMAEKLEALLVKEESEEASSKIENKN
Download sequence
Identical sequences G3ULJ1
ENSLAFP00000028700 ENSLAFP00000028700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]