SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028878 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028878
Domain Number 1 Region: 797-1134
Classification Level Classification E-value
Superfamily NHL repeat 7.59e-25
Family NHL repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 492-567
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000804
Family Pre-dockerin domain 0.057
Further Details:      
 
Domain Number 3 Region: 1030-1077,1105-1123,1150-1263
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00000259
Family YVTN repeat 0.048
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000028878
Domain Number - Region: 235-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000352
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 332-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000553
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 302-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.096
Further Details:      
 
Domain Number - Region: 168-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00201
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 203-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00268
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 370-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00521
Family EGF-type module 0.08
Further Details:      
 
Domain Number - Region: 138-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 268-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family Integrin beta EGF-like domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028878   Gene: ENSLAFG00000003864   Transcript: ENSLAFT00000026698
Sequence length 2334
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:90584358:90801687:1 gene:ENSLAFG00000003864 transcript:ENSLAFT00000026698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLKFNISLGKDALFGVYIRRGLPP
SHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVFVQYLDVGLWHLAFYNDGKDKE
MVSFNTVVLDSVQDCPRNCHGNGECVSGLCHCFPGFLGADCAKAACPVLCSGNGQYSKGT
CQCYSGWKGAECDVPLNQCIDPSCGGHGSCIDGNCVCSAGYKGEHCEEVDCLDPTCSSHG
VCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDTGLCSCDPNWMGPDCSVEVCSV
DCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTCKDGKCECREGWNGEHCTIEHF
LCRIVRTYGCPDLCSGNGRCTLGQNSWQCVCQTGWRGPGCNVAMETSCADNKDNEGDGLV
DCLDPDCCLQSACQNSPLCRGSRDPLDIIQQGQTALPVVKSFYDRIKLLAGKDSTHIIPG
DNPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYTITRQDGTFDLIANGGASLTL
HFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCDLSGFVRPDPIIISSPLSTFF
SAAPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYKSLLKITMTQSTVPLNLIKVH
LMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLSDAVVSVGFEYETCPSLILWE
KRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGENQFLTQQPAIITSIMGNGRR
RSISCPSCNGLAEGNKLLAPVALAVGIDGSLFVGDFNYIRRIFPSRNVTSILELRNKEFK
HSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRIKSLSGSKDLAGNSEVVAGTGEQCLPFD
EARCGDGGKAVDATLMSPRGIAVDKNGLMYFVDATMIRKVDQNGIISTLLGSNDLTAVRP
LSCDSSMDVAQVRLEWPTDLAVNPMDNSLYVLENNVILRITENHQVSIIAGRPMHCQVPG
IDYSLSKLAIHSALESASAIAISHTGVLYITETDEKKINRLRQVTTNGEICLLAGAASDC
DCKNDVNCNCYSGDDAYATDAILNSPSSLAVAPDGTIYIADLGNIRIRAVSKNKPVLNAF
NQYEAASPGEQELYVFNADGIHQYTVSLVTGEYLYNFTYSADNDVTELIDNNGNSLKIRR
DSSGMPRHLLMPDNQIITLTVGTNGGLKVVSTQNLELGLMTYDGNTGLLATKSDETGWTT
FYDYDHEGRLTNVTRPTGVVTSLHREMEKSITIDIENSNRDDDVTVITNLSSVEASYTVV
QDQVRNSYQLCNNGTLRVMYANGMGVSFHSEPHVLAGTITPTIGRCNISLPMENGLNSIE
WRLRKEQIKGKVTIFGRKLRVHGRNLLSIDYDRNIRTEKIYDDHRKFTLRIIYDQVGRPF
LWLPSSGLAAVNVSYFFNGRLAGLQRGAMSERTDIDKQGRIVSRMFADGKVWSYSYLDKS
MVLLLQSQRQYIFEYDSSDRLHAVTMPSVARHSMSTHTSIGYIRNIYNPPESNASVIFDY
SDDGRILKTSFLGTGRQVFYKYGKLSKLSEIVYDSTAVTFGYDETTGVLKMVNLQSGGFS
CTIRYRKIGPLVDKQIYRFSEEGMVNARFDYTYHDNSFRIASIKPVISETPLPVDLYRYD
EISGKVEHFGKFGVIYYDINQIITTAVMTLSKHFDTHGRIKEVQYEMFRSLMYWMTVQYD
SMGRVIKRELKLGPYANTTKYTYDYDGDGQLQSVAVNDRPTWRYSYDLNGNLHLLNPGNN
VRLMPLRYDLRDRITRLGDVQYKIDDDGYLCQRGSDIFEYNSKGLLTRAYNKVSGWTVQY
RYDGVGRRASYKTNLGHHLQYFYSDLHNPTRITHVYNHSNSEITSLYYDLQGHLFAMESS
SGEEYYVASDNTGTPLAVFSINGLMIKQLQYTAYGEIYYDSNPDFQMVIGFHGGLYDPLT
KLVHFTQRDYDVLAGRWTSPDYTMWKNVGKEPAPFNLYMFKSNNPLSNELDLKNYVTDVK
SWLVMFGFQLSNIIPGFPRAKMYFVPPPYELSESQASENGQLITGIQQTTERHNQAFMAL
EGQVISKKLHASIREKAGHWFATTTPIIGKGIMFAIKEGRVTTGVSSIASEDSRKVASVL
NNAYYLDKMHYSIEGKDTHYFVKIGAADSDLVTLGTTIGRKVLESGVNVTVSQPTLLVNG
RTRRFTNIEFQYSTLLLSIRYGLTPDTLDEEKARVLDQARQRALGTAWAKEQQKARDGRE
GSRLWTEGEKQQLLSTGRVQGYEGYYVLPVEQYPELADSSSNIQFLRQNEMGKR
Download sequence
Identical sequences G3UM19
ENSLAFP00000028878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]