SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028952 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028952
Domain Number 1 Region: 290-420
Classification Level Classification E-value
Superfamily PH domain-like 7.84e-36
Family Ran-binding domain 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028952   Gene: ENSLAFG00000001841   Transcript: ENSLAFT00000032846
Sequence length 473
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_119:1383762:1414600:1 gene:ENSLAFG00000001841 transcript:ENSLAFT00000032846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLTQFPPSQSEEKSSGFRLKPPTLIHGQ
APSAGLPSQKPKEQQRSVLRPAVLQAPQPKVSSQAVPSSGTNGVSIPTDCTGPVTSILPD
NPARRSPSESTDEAQAFEEKEPQKNESSNTSEEENCEKKEQVAQQAFVFGQNLRDRVKLI
NENTDVADVENAGHLSSEAPTATNYFLQYISSSLENSTNSADASSNKFVFGQNMSARVLS
PPKLNEVSSDANRENTAAESGSESSSQEATPEKESLAESAAAYTKATARKCLLEKVEVIT
GEEAESNVLQIQCKLFVFDKASQSWVERGRGLLRLNDMASADDGTLQSRLVMRTQGSLRL
ILNTKLWAQMQIDKASEKSVRVTATDTEDQAVKVFLISASSKDTGQLYAALHHRILALRS
RVEQEQEAKMPAPEPGVAPSNEDDSDDDDVLAPSGATGGGAGDEGDGPTAGST
Download sequence
Identical sequences G3UM93
ENSLAFP00000028952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]