SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000028982 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000028982
Domain Number 1 Region: 1197-1420
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-59
Family DBL homology domain (DH-domain) 0.00000000329
Further Details:      
 
Domain Number 2 Region: 1420-1560
Classification Level Classification E-value
Superfamily PH domain-like 7.96e-33
Family Pleckstrin-homology domain (PH domain) 0.000000217
Further Details:      
 
Domain Number 3 Region: 238-339
Classification Level Classification E-value
Superfamily EF-hand 5.17e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1574-1694
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.05e-26
Family PLC-like (P variant) 0.012
Further Details:      
 
Domain Number 5 Region: 8-105
Classification Level Classification E-value
Superfamily EF-hand 1.09e-25
Family Eps15 homology domain (EH domain) 0.0018
Further Details:      
 
Domain Number 6 Region: 1123-1199
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-25
Family SH3-domain 0.0000451
Further Details:      
 
Domain Number 7 Region: 770-850
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-19
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 8 Region: 904-983
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-19
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 9 Region: 976-1045
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-18
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 10 Region: 1060-1128
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-17
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000028982   Gene: ENSLAFG00000001327   Transcript: ENSLAFT00000032498
Sequence length 1700
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_13:22110838:22280255:-1 gene:ENSLAFG00000001327 transcript:ENSLAFT00000032498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQFPTRFGGSLDIWAITVEERAKHDQQFHSLKPTSGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPSVMKQQPVTISSAPVFQMYFV
VHSIKQLTTLNPFQSTPPLTAVAPVPMGSIPVVGMSPPLVSSVPPAAVPPLANGAPPVVQ
PLPAFAHAATLPKSSSFSRSGPGTQLNTKLQKAQSFDVARSKIGCSHNESSLSAPPHSAP
PVAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQTQLASIWNLSDIDQ
DGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRARSGSGISAVSSSSVDQRLL
EEPVLEDEQQQLEKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAE
QERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWE
RNRRQELLNQRNREQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLTTQRQDI
ESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILNDQLKQVQQNSLHSRLGDSLLT
VKRALEAKELARQQLRDQLDEVEKETRAKLQEIDIFNNQLKKAFNTPDATLQNFCILHLF
SCMNSEVMVLQEELREIHNKQQLQKQKSVEAERLKQKEQERKILELEKQKEEAQSRRAQE
RDKQWLEHVQLEDEHQRPRKLHDEERPKRDESVKKKDSEEKGMQDKENVKVVYYRALYPF
ESRSHDEITIQPGDIVMVDESQTGEPGWLGGELKGKTGWFPANYAEKISENEVPAPVKTV
TDPTSAPWPTSTSEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQ
GEKVEGLQAQALYPWRAKKDNHLNFNKNDVIAVLEQQDMWWFGEVQGQKGWFPKSYVKLV
SGPTRKSTRPNAFFPTVNKSPASSVYGTVGSEFIAMYTYESSEQGDLTFQQGDVLLVTKK
DGDWWTGTVGDRSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYTATGPEQLT
LAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTEPPMCQVI
GMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDMDPSQQW
CSDLHLLDMLTPTERKRQGYIHELLVTEENYVNDLQLVTEIFQKPLMESELLTEKEVAMI
FVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSCQLNGAA
LIQQKTDEAPDFKDFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLLRICLILENTPENH
PDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGP
RKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIIKPLGSSGTDKVFSPKSNLQYKMYKTPI
FLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKK
REKAYLVRSQRATGIGRLMVNIVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLN
PKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLL
LHEVPTGEIVVRLDLQLFDE
Download sequence
Identical sequences G3UMC3
ENSLAFP00000028982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]