SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000029215 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000029215
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.93e-63
Family Pancreatic carboxypeptidases 0.00000224
Further Details:      
 
Domain Number 2 Region: 270-331
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.06e-17
Family Carboxypeptidase regulatory domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000029215   Gene: ENSLAFG00000032054   Transcript: ENSLAFT00000025747
Sequence length 332
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_18:842762:859762:1 gene:ENSLAFG00000032054 transcript:ENSLAFT00000025747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVEPEVKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLINTTRIHLLPSMNPDG
YEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAGVRGARSDHIPVPQHYWWG
KVAPETKAVMKWTRTIPFVLSASLHGGDLVVSYPFDFSQHPQEEKMFSPTPDEKMFKLLA
RAYADVHPMMMDQSEHRCGGNFLRRGSVINGADWYSFTGGMSDFNYLHTNCFEITVELGC
VKFPPKEALYTLWQHNKESLLNFVEMVHRGIKGVVMDKFGKPVKNARVVVKGIRHDVTTA
PDGDYWRLLPPGSHIVIAQAPGYSRVIKKVTI
Download sequence
Identical sequences G3UN06
ENSLAFP00000029215 ENSLAFP00000029215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]