SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000029320 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000029320
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000029320   Gene: ENSLAFG00000013995   Transcript: ENSLAFT00000029296
Sequence length 445
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_64:7639125:7762689:1 gene:ENSLAFG00000013995 transcript:ENSLAFT00000029296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSCVTVFRVPHQEENGCADFFI
HGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAI
EDISQGCPASKNEAEEPEDDLQAPEEDTSSSLVKDHLFQQDTVITSEPYRSSNIRPSPFE
DLNARRAYVQSQANQITFSQPGLDIQSRGMEYVQRQISKECGSLKSQNRVPLKSIRHVSF
QDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDTDTSIPFSKPDSKKSDYLYSCGDE
TKLSSLKDSVVFKTQPSSLKFKKSKRRKEDGERSRCVYCQERFNHEENGRGKCQDAPDPI
KRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCC
YVPLRMCHRCGEACGCCGGKHKAAG
Download sequence
Identical sequences G3UNB1
XP_010596627.1.64505 ENSLAFP00000029320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]