SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000439 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000439
Domain Number 1 Region: 39-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 4.03e-36
Family SCAN domain 0.0000561
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 435-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 631-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 6 Region: 213-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000262
Family KRAB domain (Kruppel-associated box) 0.0084
Further Details:      
 
Domain Number 7 Region: 518-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000153
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 376-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000856
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000439   Gene: ENSLAFG00000000525   Transcript: ENSLAFT00000000524
Sequence length 685
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_53:12010986:12019143:-1 gene:ENSLAFG00000000525 transcript:ENSLAFT00000000524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMASGPGSQEQEGLLIVKLEEDCAWSQELPRPDPGSSLHSSHLRFRRFRFQEAAGPREA
LSRLQELCHEWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVED
MQRELGRLRQQVTNHGQGTAVLLEEPLPLETARESPSFKLEPMETERSPGPRLQQLLGPS
PQRDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYLSQEDCRHLEPGK
RALSRDTVQENYKNVDSLESPIPNHGALSTQVEPGGKPWDPRVQSCKERRRPQSPAAGEE
KFENRDETAQSVAPENTHPKELPGQARGEVPWSPEQGRPCDRSEGQWDPPPEDQMEQSLV
RATSYRELGRPKELQPKKLHICSLCGKNFSNNSNLIRHQRIHAAERLCMGVECGDIFGGN
PHFLSLHRAQLGEEAHKCLECGKSFSQNTHLIRHQRTHTGEKPYRCNVCGKSFSCNSNLH
RHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHER
THERERLYPFSACGEAVSDCTPFLSNHGAPKVEKKLFKCLTCGKSFGQGMHLTRHQRTHT
GEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERP
YKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences G3SLV8
ENSLAFP00000000439 ENSLAFP00000000439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]