SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000457 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000457
Domain Number 1 Region: 733-961
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-58
Family DBL homology domain (DH-domain) 0.000000000966
Further Details:      
 
Domain Number 2 Region: 337-515
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-54
Family Regulator of G-protein signaling, RGS 0.0000000238
Further Details:      
 
Domain Number 3 Region: 966-1098
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-43
Family Pleckstrin-homology domain (PH domain) 0.000000384
Further Details:      
 
Domain Number 4 Region: 27-121
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-21
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000457   Gene: ENSLAFG00000000541   Transcript: ENSLAFT00000000544
Sequence length 1558
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:5396432:5448241:-1 gene:ENSLAFG00000000541 transcript:ENSLAFT00000000544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMCFFYSFSRLSSLSSLGDSASERKSPSHHHEPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPAPAGGPRVTPMMRITGPKPLQDPEFQKHATQILRNMLRQEEKEL
QRICEVYNRNPASLLEEQIEGARRRVSQLQLKIQQETGGLVDVLPLYGDTSQRSSEGRLS
LDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMARMAQHHRRQGSDA
PVPPSSDQGVDQSPKPLIIGPEEDYDPGYFNNEGNIIFQDLEKLKSRPAHLGVFLRYILS
QADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRN
SEDIRSVLCEAQEAAMPEIQEQIHDYRVRTKRTLGLGSLYGENDLLDLDGDPLRERQVAE
KQLAALGDILSKYEEDRSAPMDFALNTYMSYAGIRLREARPSNPAEKAQSAPDKDKWLPF
FPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKNSSQSIKPGNVRNIIQHFENNQQYDAP
EPGTQRLSTGSFPEDLLEGDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDA
AAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPSLVFCTDALLPHPLEDDL
GQLSDLEPELDAQNWQHTVGKDVVAGLSQREIDRKEVINELFVTEASHLRTLRVLDLIFY
QRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPA
REELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQR
LTKYPLLLENIIKHTEGGTCEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLD
TTSLERASNLLAVEFKSLDLTTRRMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDE
KLLLKCHSKTAAGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVA
LTSSDKNTWMELLEEAVRNATRHPGTAPPPVHPPPPGPQGAAHQGPAPSRVGLDDSEAFP
RRCSEPEPEELPGDIGPQQRIRGTHPVLPEDPEQEGTGEEEKLGALPHPSSSLVGENTGI
RTRDPIHLPLPGPLFMEGLAEAALEDVENLRHLILWRLLPSHTTEPQATGEPEDDLTPTP
SVISVTSHPWDPGSPGRAPAGGEGDNAQLPGLEGSRPELEDGAPCSLEHLPPRTRNSGIW
ELPELDRSPAEEVSSTEAAGTYKVVRKADLPSLLGGGGVGAADVAGSKVVPALPESGQSE
PEPPDVEGGAKAAGNCFYVSMPAGPLDSSTETSGAPTSPPQPDGLPTWQAEPQPQLRGGN
GDQRHSSRSPPSLGLRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGGESSGGTTPV
GSFHTEAARWTDSSLSPPAKEPLVSDSRDSHELGPCPEDSSDTPLEDRVAAAATTPGL
Download sequence
Identical sequences G3SLX3
ENSLAFP00000000457 ENSLAFP00000000457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]