SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000653 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000653
Domain Number 1 Region: 64-339
Classification Level Classification E-value
Superfamily NHL repeat 1.36e-23
Family NHL repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000653   Gene: ENSLAFG00000000773   Transcript: ENSLAFT00000000774
Sequence length 351
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_23:38380291:38393630:-1 gene:ENSLAFG00000000773 transcript:ENSLAFT00000000774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFWVCVAGAGAGLFLTFLVLHSCFCGSPILRNFVFQISWTPENIRYRLDVGWPKYSEY
FSGTTFCVAVDSFNGLVYVAQQTGVNIPKVLVFTEDGYFLRAWNDTVDTPHGIFAASTPY
ERSVWITDVGSGSYGHTVKKYNSFGDLIQVLGTPGKKGTDLNPLQFDNPAELYVEDTGDI
YIVDGDGGLNNRLFKLSQDFMILWLHGENGTGPTQFNIPHSVTVDSAGRVWVADRGNKRI
QVFDKDTGEWLGAWDNCFTEEGPSSVRFTPDGKYLIVAQLNLSRLSFVAAPPVGSIGSCS
VVSTLQLADQVLPHLLDVDRKTGAIYVAEIGARQVQKYVPLKSRFIPAFGE
Download sequence
Identical sequences G3SMC7
ENSLAFP00000000653 ENSLAFP00000000653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]