SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000833 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000833
Domain Number 1 Region: 26-191
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-33
Family Laminin G-like module 0.000000347
Further Details:      
 
Domain Number 2 Region: 210-385
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000317
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000833   Gene: ENSLAFG00000000994   Transcript: ENSLAFT00000000994
Sequence length 395
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:11655894:11660291:1 gene:ENSLAFG00000000994 transcript:ENSLAFT00000000994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKVTSAPSFLKLLALVTNPHTQQGLAVPTQRPQDSPALHLCSGLGQEPVTVMTFDVTKIT
KTSSSFELQTWDPEGVIFYGDTNPNDDWFMLGLRDGGPEIQLHNHWAQLTVGTGPPLDDG
RWHQVEVKMDGDSVVLLVDGEEVLHLRQVSGPLARKPQPIMKIALGGLLFPSSNLRLPLV
PALDGCLRRDVWLDRRAQISASAPTSTRNCAVESQPGVFFPPGTHAEFSLQDIPQPHAET
WAFSLELGLQLAAGAGRLLALGTLANSPWLSLHFQDQKVVLSSGPGPGLDLPLVSGLPLQ
LKMDLSRVVLSQGLKEEVLALPPLGLDPLSNLWDQTQGYLFLGAVPGQASSSSFCLHDLW
AQGQRLDMDRALSRSQDIWTHSCPQSLGNGTDTSH
Download sequence
Identical sequences G3SMR5
ENSLAFP00000000833 ENSLAFP00000000833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]