SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001593 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001593
Domain Number 1 Region: 154-334
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-38
Family Prokaryotic proteases 0.00000525
Further Details:      
 
Domain Number 2 Region: 371-466
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-19
Family HtrA-like serine proteases 0.0012
Further Details:      
 
Domain Number 3 Region: 36-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000769
Family Growth factor receptor domain 0.003
Further Details:      
 
Domain Number 4 Region: 91-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000707
Family Ovomucoid domain III-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001593   Gene: ENSLAFG00000001907   Transcript: ENSLAFT00000001907
Sequence length 471
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_18:525550:581609:1 gene:ENSLAFG00000001907 transcript:ENSLAFT00000001907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAMQARALLLAALAALAALAALAELALAQELTAPSCSERCNVSRCLSPRCPSGYMPDRCK
CCLVCAAGEGEPCGRPLDSPCGESLECARGACRCRWIHAVCGTDGHTYANVCALLAASRR
SLKLTGMPVRQLQKGVCPSALEQLTSPRYKFNFIADVVEKIAPAVVHIDVFLRHPLFGRN
VPMSSGSGFIVSEAGMIVTNAHVVSKTNAVSGQWQLKVQLQNGDVYEATIRDVDKKLDIA
IIKIHPTRKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSAAQRDGKELGLQDS
DMDYIQTDAIINVGEAVGPHIKRTGCVRGWNTTVGTASIILPFPEYFLLTFIELQVNVYK
SSQSVTYLKKRFIGIRMRTITPSLVQELKANNLNFPEVSSGIYVQEVLPNSPCQRSGIED
GDVIVKVNGRPLVNANDMQEAVLTESQLLLEVLRGSENLLFSISPEVVLDP
Download sequence
Identical sequences G3SPG4
ENSLAFP00000001593 ENSLAFP00000001593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]