SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001629 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001629
Domain Number 1 Region: 257-433
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-52
Family SPRY domain 0.00019
Further Details:      
 
Domain Number 2 Region: 17-77
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000382
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001629   Gene: ENSLAFG00000001948   Transcript: ENSLAFT00000001946
Sequence length 440
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:61162318:61190489:1 gene:ENSLAFG00000001948 transcript:ENSLAFT00000001946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATNGTPEGPGAAEPKEARVWRCLEHDDRVAELFCRRCDRCVCALCPVLGAHRGHPVRLAL
EEAALVQKITQNCLKQLATKKQQEVDNITQIEDAAEKLKAHAESSKTWLAGKFSELRLLL
DEEEVLAKKFIDRNMQLALQAYRQQIESCGEHINVMNDLSHRAWSISQEPDPVQRLQAYS
ATRQEMQQQMNLGELCHPVPLSFEPVKSLFKGLVEAIQSALQMPLDIRIKENMNCQLSGS
SSTKPGTLLKTGLSPERSLFLKYARTPTLEPDTMHARLRLSADRLTVRCGLWGRLGPASA
LRFDALWQVLGRDGFAAGRHYWEVDVQEAGAGWWVGAAYASMRRCGSSDAARLGCNRQSW
CLKRYDLEYWAFHDGQRSRLRPRDDPDRLGVFLDYEAGVLAFYDVTGGMSHLHTFRGTFL
EPLYPALRLWEGAISIPRLP
Download sequence
Identical sequences G3SPJ1
ENSLAFP00000001629 ENSLAFP00000001629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]