SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004252 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004252
Domain Number 1 Region: 772-953
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-44
Family Ypt/Rab-GAP domain of gyp1p 0.004
Further Details:      
 
Domain Number 2 Region: 928-1049
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 156-190,229-375
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-30
Family Phosphotyrosine-binding domain (PTB) 0.006
Further Details:      
 
Domain Number 4 Region: 14-155
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-20
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004252   Gene: ENSLAFG00000005076   Transcript: ENSLAFT00000005082
Sequence length 1167
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_18:40607445:40874352:1 gene:ENSLAFG00000005076 transcript:ENSLAFT00000005082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPNEVSVDFGLQLVGSLPVHSLTTMPMLPWIVAEVRRLSTSRKGPVTK
QVRLCVSPSGLRCEHEPGKSQQWDPLLCSSIFECKPQQVHKLIHNSHDPSYFACLIKEDV
ASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFAKKFEVLFCGRVT
VAHKKAPPALIDECIEKFNHISCSRKSEFDLLSQNSETPVGHEEQGRRPMRKSFSQPGLR
SLAFKKEFQDESLRSSRFFSSFEENDIESHLMSGHNVVQPTDIEENRTMLFTIGQSEVYL
ISPDTKKIAFEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALVDE
IMMTLKQAFTVAAVQRTSKAPAQLCEGCPVQCLHKLCERIEGMNTSKTKLELQKHLTTLT
NQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKDHVHIGEMKQTSQVAAENIGS
ELLPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGPPQEPSLSVDLDSSVSSTLSNT
SKEPSVCEKEALAVSESSFKLLSSSDDLSSDSESHLSEEAAQLSPQQGFRRRANTLSHLP
TESQELPEPAEVSPGVSQRKLMRYHSVSTETPHERKDFETKTNHPGDASGTPVKTRRHSW
RQQIFLRVATPQKACDSPSRYEDYPDLGELPPRSPLEPVCEDGSSGLVPEEKKRTSRELR
ELWQKAILQQILLLRMEKENQKLQASESDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTP
GRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQYHLRHQFPSKQQPKDTPYKELLKQL
TSHQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILL
LHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIG
PSLYAAPWFLTVFASQFPLGFVARVFDMIFLQGSEVVFKVALSLLGSHKPLILQHENLET
IVDFIKNTLPNLGLVQMEKTINQVFEMDISKQLQAYEVEYHVLQEELIDSSPLSDNQRMD
KLEKTNSSLRKQNLDLLEQLQVANSRIQSLEATVEKLLTSENKLKQATLALELERSALLQ
TVEELRRQTAGLSRTEPAPADPEPAGD
Download sequence
Identical sequences G3SVI3
ENSLAFP00000004252 ENSLAFP00000004252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]