SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004258 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004258
Domain Number 1 Region: 231-505
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.83e-79
Family Mitochondrial carrier 0.0000684
Further Details:      
 
Domain Number 2 Region: 43-223
Classification Level Classification E-value
Superfamily EF-hand 4.15e-34
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004258   Gene: ENSLAFG00000005089   Transcript: ENSLAFT00000005091
Sequence length 514
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:29962823:29992234:-1 gene:ENSLAFG00000005089 transcript:ENSLAFT00000005091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSVLCRCVASPPPDAAAAASSSASSPASTGDPCGGAVCGGPDHRLRLWSLFQTLDVNR
DGGLCVNDLAVGLPRLGLHRTEGELRKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVF
KSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTID
WNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGG
AGAVSRTCTAPLDRLKVLMQVHASRTNNMCIIGGFTQMIREGGVRSLWRGNGINVLKIAP
ESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQ
YSGMLDCARKILAKEGIAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQRYAVNSADP
GVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKQILRTEGAFGL
YRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences G3SVI8
ENSLAFP00000004258 ENSLAFP00000022756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]